PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Carubv10019483m
Common NameCARUB_v10019483mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Camelineae; Capsella
Family MYB
Protein Properties Length: 297aa    MW: 33783.7 Da    PI: 6.6073
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Carubv10019483mgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding42.81.2e-131055146
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46
                     +g+W +eEde l++ vk++G+++W++I ++  + Rt+k+c++rw +
  Carubv10019483m 10 KGPWKAEEDEVLINHVKRYGPRDWSSIRSKGLLQRTGKSCRLRWVN 55
                     79*************************8887799**********87 PP

2Myb_DNA-binding39.31.5e-1266105344
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 
                      +++++E+   +++  ++G++ W++Ia +++ gRt++++k++w
  Carubv10019483m  66 KFSADEERVVIELQSEFGNK-WARIATYLP-GRTDNDVKNFW 105
                      79******************.*********.*********** PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-22458IPR009057Homeodomain-like
PROSITE profilePS5129421.325561IPR017930Myb domain
SuperFamilySSF466897.03E-288105IPR009057Homeodomain-like
SMARTSM007177.1E-11959IPR001005SANT/Myb domain
CDDcd001671.04E-101257No hitNo description
PfamPF139217.6E-121363No hitNo description
Gene3DG3DSA:1.10.10.601.7E-1759111IPR009057Homeodomain-like
PROSITE profilePS5129417.74962113IPR017930Myb domain
SMARTSM007171.7E-1163111IPR001005SANT/Myb domain
PfamPF002492.8E-1166105IPR001005SANT/Myb domain
CDDcd001672.43E-966105No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0048235Biological Processpollen sperm cell differentiation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 297 aa     Download sequence    Send to blast
MEAKKEEIKK GPWKAEEDEV LINHVKRYGP RDWSSIRSKG LLQRTGKSCR LRWVNKLRPN  60
LKNGCKFSAD EERVVIELQS EFGNKWARIA TYLPGRTDND VKNFWSSRQK RLARILHNSS  120
SDASTSSFNP KSSSSSHRSK GKNVKPIRQS CKPTQGFGLV EEEVTVSYSS DQVHDEALRL  180
PDLGIKLEHQ PFTFGTDLVL ADFSDSHDDA NQQAIIPFSP ESRELLARLD DPFYYDILGP  240
ADSSEPLFAL PQPFFEPSPA PRRCRHVSKD EEHDDDVFLH DFPADMFDQV DPIRSP*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C5e-28711124126MYB TRANSFORMING PROTEIN
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAF4694680.0AF469468.1 Arabidopsis thaliana putative transcription factor (MYB125) mRNA, complete cds.
GenBankHM7765210.0HM776521.1 Arabidopsis thaliana duo pollen 1 (DUO1) mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006293167.10.0hypothetical protein CARUB_v10019483mg
TrEMBLR0HLG70.0R0HLG7_9BRAS; Uncharacterized protein
STRINGAT3G60460.10.0(Arabidopsis thaliana)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM65512842
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G60460.11e-180MYB family protein